PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016501975.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 498aa    MW: 55400.6 Da    PI: 6.8619
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016501975.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.11.9e-32295352260
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                     ++vrY+eClkNhA+ +GghavDGC++fmp+ geegt++alkCaAC+CHRnFHR+eve e
  XP_016501975.1 295 SSVRYRECLKNHAVGIGGHAVDGCRDFMPA-GEEGTMDALKCAACNCHRNFHRKEVEGE 352
                     679**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF142237.9E-868149No hitNo description
CDDcd092723.56E-36151244No hitNo description
PfamPF047701.4E-29297349IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-23297350IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.1E-28298349IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.645299348IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466896.45E-20421496IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-31422497IPR009057Homeodomain-like
TIGRFAMsTIGR015656.4E-25435491IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MSNENQTNEN VAGTGATITS VAASSSRSTP AHAMAPAEKP GKRFIKEDPP VLAEGTPDDE  60
RFVVTEAWKH SDFLGKNYIL SCLEDSLYNI YSVMETSKTL RNALEKKYKT EDASLKKFVA  120
ASFLDFKMID TRSVITQVQE LQVIVHDLLT EGYSDANWIT GSTETKSTSG YIFIVGGGAV  180
SWKSSKQTCI ARSTMESEFI ALDKADEEAE WLRNFLEDIP FWPKPLAPIC IHCDSEAAIG  240
RAGNCRFXEE HEEQEEEIGN IHQISSAAAN VNFQTQGNNS VRGVEEGVST TVRKSSVRYR  300
ECLKNHAVGI GGHAVDGCRD FMPAGEEGTM DALKCAACNC HRNFHRKEVE GEVFHHTPPP  360
HLTHHHPQPH HSHHPQFSPY TSYRTPHHPS GYLHVNPPPH QRPLALPSTS REDEDMSNPS  420
SSGGGGSGGV GGSSRKRFRT KFTADQKDKM LAFAERLGWR MQKQDEALVQ QFCAETNVQR  480
HVFKVWMHNN KHTLGKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-254364931875ZF-HD homeobox family protein
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755161e-113HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016501975.10.0PREDICTED: uncharacterized protein LOC107820239
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-66homeobox protein 22